PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_63478_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family SBP
Protein Properties Length: 154aa    MW: 17497.2 Da    PI: 8.7604
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_63478_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.36.9e-4177152277
                                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                                  SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                                          C ve+C++d+++ k y+rrhkvC +h+ka+vvl++g+++rfCqqCsrfhel+efD++krsCrrrLa+hnerrrk
  cra_locus_63478_iso_2_len_460_ver_3  77 CLVENCTTDMTDGKPYYRRHKVCAFHAKAAVVLLAGTQKRFCQQCSRFHELTEFDDAKRSCRRRLAGHNERRRK 150
                                          ************************************************************************** PP

                                          -- CS
                                  SBP  76 kq 77 
                                          ++
  cra_locus_63478_iso_2_len_460_ver_3 151 SS 152
                                          86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.9E-3170138IPR004333Transcription factor, SBP-box
PROSITE profilePS5114130.17174151IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.06E-3676152IPR004333Transcription factor, SBP-box
PfamPF031103.0E-3177150IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
XSSDLGRGGS LVSPSFQLQF HWFHLCKGME TSTEGKTIVE VPLSDEETEE EENKNKRAMT  60
PCARKAYSAS GSSQISCLVE NCTTDMTDGK PYYRRHKVCA FHAKAAVVLL AGTQKRFCQQ  120
CSRFHELTEF DDAKRSCRRR LAGHNERRRK SSYX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-3569150284squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096328.12e-51PREDICTED: squamosa promoter-binding protein 1
SwissprotQ387414e-54SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A075FJ683e-51A0A075FJ68_SALMI; SQUAM
TrEMBLA0A075BSE57e-51A0A075BSE5_POGCB; Squamosa promoter binding protein-like 4 (Fragment)
STRINGSolyc02g077920.2.18e-45(Solanum lycopersicum)